Glyma13g02740 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g02740

Feature Type:	gene_model
Chromosome:	Gm13
Start:	2707720
stop:	2712881
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g02740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08640	AT	Annotation by Michelle Graham. TAIR10: flavonol synthase 1 \| chr5:2804009-2805175 FORWARD LENGTH=336	SoyBase	E_val: 8.00E-150	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0009718	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009813	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010224	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV-B	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016706	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors	SoyBase	N/A	ISS
GO:0045431	GO-mf	Annotation by Michelle Graham. GO Molecular Function: flavonol synthase activity	SoyBase	N/A	ISS
KOG0143	KOG	Iron/ascorbate family oxidoreductases	JGI		ISS
PTHR10209	Panther	FE(II)/ ASCORBATE OXIDASE SUPERFAMILY	JGI		ISS
PTHR10209:SF55	Panther	OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI	JGI		ISS
PF03171	PFAM	2OG-Fe(II) oxygenase superfamily	JGI		ISS
UniRef100_Q0EDG6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Flavonol synthase n=1 Tax=Glycine max RepID=Q0EDG6_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q0EDG6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase n=1 Tax=Glycine max RepID=Q0EDG6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma13g02740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g02740

Paralog	Evidence	Comments
Glyma14g33227	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g02740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g082300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g02740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g02740

Limit To All Plant Sequences

>Glyma13g02740.1   sequence type=CDS   gene model=Glyma13g02740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGTGCTAAGGGTGCAAACCATAGCTTCCAAATCCAAAGATGCTGCCATCCCAGCCATGTTTGTTAGGGCAGAGACAGAGCAACCAGGCATCACAACCGTTCAAGGGGTGAACCTTGAGGTGCCAATTATTGATTTTAGTGACCCAGATGAAGGGAAAGTGGTGCATGAGATTTTGGAGGCAAGTAGGGACTGGGGCATGTTCCAAATTGTGAACCATGACATACCTAGTGATGTTATAAGAAAGTTGCAAAGTGTTGGGAAAATGTTCTTTGAGTTGCCACAAGAGGAAAAAGAGTTGATTGCTAAGCCTGCTGGGTCTGATTCTATTGAAGGGTATGGCACAAAGCTTCAGAAAGAGGTGAATGGCAAGAAAGGGTGGGTGGATCATTTGTTCCACATTGTGTGGCCTCCTTCCTCCATCAACTACAGTTTCTGGCCCCAAAACCCCCCTTCTTACAGGGAAGTTAATGAGGAATATTGCAAGCACCTAAGAGGAGTGGTAGACAAATTGTTCAAAAGTATGTCGGTAGGGTTGGGGCTTGAAGAGAATGAGCTAAAGGAGGGTGCAAATGAAGATGACATGCATTATCTTTTAAAAATCAATTATTACCCACCTTGTCCATGTCCTGATCTGGTCTTGGGTGTGCCACCACACACAGACATGTCCTACCTCACAATTCTGGTGCCTAACGAGGTGCAGGGCCTTCAAGCATGTAGGGATGGCCATTGGTACGATGTTAAGTATGTCCCCAATGCCCTCGTTATTCACATTGGCGACCAAATGGAGATACTGAGCAATGGAAAATATAAGGCAGTTTTTCACAGAACAACAGTGAACAAAGATGAGACAAGAATGTCGTGGCCCGTGTTCATAGAACCCAAAAAGGAACAAGAAGTTGGTCCTCACCCAAAGTTGGTTAACCAAGACAATCCACCAAAATACAAAACCAAGAAATACAAGGATTATGCTTATTGTAAGCTCAATAAGATCCCTCAATGA

Predicted protein sequences of Glyma13g02740

Limit To All Plant Sequences

>Glyma13g02740.1   sequence type=predicted peptide   gene model=Glyma13g02740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVLRVQTIASKSKDAAIPAMFVRAETEQPGITTVQGVNLEVPIIDFSDPDEGKVVHEILEASRDWGMFQIVNHDIPSDVIRKLQSVGKMFFELPQEEKELIAKPAGSDSIEGYGTKLQKEVNGKKGWVDHLFHIVWPPSSINYSFWPQNPPSYREVNEEYCKHLRGVVDKLFKSMSVGLGLEENELKEGANEDDMHYLLKINYYPPCPCPDLVLGVPPHTDMSYLTILVPNEVQGLQACRDGHWYDVKYVPNALVIHIGDQMEILSNGKYKAVFHRTTVNKDETRMSWPVFIEPKKEQEVGPHPKLVNQDNPPKYKTKKYKDYAYCKLNKIPQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain